Lineage for d1ja1b3 (1ja1 B:519-678)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2468137Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins)
  6. 2468138Protein NADPH-cytochrome p450 reductase [52366] (1 species)
  7. 2468139Species Norway rat (Rattus norvegicus) [TaxId:10116] [52367] (4 PDB entries)
  8. 2468141Domain d1ja1b3: 1ja1 B:519-678 [62808]
    Other proteins in same PDB: d1ja1a1, d1ja1a2, d1ja1b1, d1ja1b2
    complexed with epe, fad, fmn, nap; mutant

Details for d1ja1b3

PDB Entry: 1ja1 (more details), 1.8 Å

PDB Description: cypor-triple mutant
PDB Compounds: (B:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1ja1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja1b3 c.25.1.4 (B:519-678) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevgetllyygcrrsdedylyree
larfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwkliheggahiyvagdarnmak
dvqntfydivaefgpmehtqavdyvkklmtkgryslnvws

SCOPe Domain Coordinates for d1ja1b3:

Click to download the PDB-style file with coordinates for d1ja1b3.
(The format of our PDB-style files is described here.)

Timeline for d1ja1b3: