Lineage for d1ja1b2 (1ja1 B:65-239)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856501Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins)
  6. 2856502Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species)
  7. 2856505Species Norway rat (Rattus norvegicus) [TaxId:10116] [52233] (4 PDB entries)
  8. 2856507Domain d1ja1b2: 1ja1 B:65-239 [62807]
    Other proteins in same PDB: d1ja1a1, d1ja1a3, d1ja1b1, d1ja1b3
    complexed with epe, fad, fmn, nap; mutant

Details for d1ja1b2

PDB Entry: 1ja1 (more details), 1.8 Å

PDB Description: cypor-triple mutant
PDB Compounds: (B:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1ja1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja1b2 c.23.5.2 (B:65-239) NADPH-cytochrome p450 reductase, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlss
lpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnam
gkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatgee

SCOPe Domain Coordinates for d1ja1b2:

Click to download the PDB-style file with coordinates for d1ja1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ja1b2: