Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins) |
Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52233] (4 PDB entries) |
Domain d1ja1b2: 1ja1 B:65-239 [62807] Other proteins in same PDB: d1ja1a1, d1ja1a3, d1ja1b1, d1ja1b3 complexed with epe, fad, fmn, nap; mutant |
PDB Entry: 1ja1 (more details), 1.8 Å
SCOPe Domain Sequences for d1ja1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ja1b2 c.23.5.2 (B:65-239) NADPH-cytochrome p450 reductase, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} kessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlss lpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnam gkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatgee
Timeline for d1ja1b2: