Lineage for d1ja1a1 (1ja1 A:240-518)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063096Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2063097Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2063098Protein NADPH-cytochrome p450 reductase [50439] (1 species)
  7. 2063099Species Norway rat (Rattus norvegicus) [TaxId:10116] [50440] (4 PDB entries)
  8. 2063100Domain d1ja1a1: 1ja1 A:240-518 [62803]
    Other proteins in same PDB: d1ja1a2, d1ja1a3, d1ja1b2, d1ja1b3
    complexed with epe, fad, fmn, nap; mutant

Details for d1ja1a1

PDB Entry: 1ja1 (more details), 1.8 Å

PDB Description: cypor-triple mutant
PDB Compounds: (A:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1ja1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh
pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw
vvearrhilailqdypslrppidhlcellprlqaryyaiassskvhpnsvhicavaveye
aksgrvnkgvatswlrakepagenggralvpmfvrksqf

SCOPe Domain Coordinates for d1ja1a1:

Click to download the PDB-style file with coordinates for d1ja1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ja1a1: