Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries) Uniprot P38501 |
Domain d1j9rb1: 1j9r B:4-166 [62773] complexed with cu, no2 |
PDB Entry: 1j9r (more details), 2 Å
SCOPe Domain Sequences for d1j9rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9rb1 b.6.1.3 (B:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d1j9rb1:
View in 3D Domains from other chains: (mouse over for more information) d1j9ra1, d1j9ra2, d1j9rc1, d1j9rc2 |