Lineage for d1j9ga_ (1j9g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856359Protein Flavodoxin [52220] (11 species)
  7. 2856395Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 2856416Domain d1j9ga_: 1j9g A: [62757]
    complexed with fmn; mutant

Details for d1j9ga_

PDB Entry: 1j9g (more details), 2.4 Å

PDB Description: low temperature (100k) crystal structure of flavodoxin d. vulgaris s64c mutant, monomer oxidised, at 2.4 angstrom resolution
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1j9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9ga_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOPe Domain Coordinates for d1j9ga_:

Click to download the PDB-style file with coordinates for d1j9ga_.
(The format of our PDB-style files is described here.)

Timeline for d1j9ga_: