Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (22 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
Domain d1j95b_: 1j95 B: [62750] residues 24-121 complexed with k, tba |
PDB Entry: 1j95 (more details), 2.8 Å
SCOPe Domain Sequences for d1j95b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j95b_ f.14.1.1 (B:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer
Timeline for d1j95b_: