Lineage for d1j8ja_ (1j8j A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 112553Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 112554Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 112878Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 113015Protein Plasmepsin ii (a hemoglobin-degrading enzyme) [50673] (2 species)
  7. 113016Species Plasmodium falciparum [50674] (3 PDB entries)
  8. 113023Domain d1j8ja_: 1j8j A: [62741]

Details for d1j8ja_

PDB Entry: 1j8j (more details)

PDB Description: a new class of small non-peptidyl compounds blocks plasmodium falciparum development in vitro by inhibiting plasmepsins

SCOP Domain Sequences for d1j8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ja_ b.50.1.2 (A:) Plasmepsin ii (a hemoglobin-degrading enzyme) {Plasmodium falciparum}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1j8ja_:

Click to download the PDB-style file with coordinates for d1j8ja_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ja_: