SCOPe 2.08: Domain d1j87a1: 1j87 A:1-85

Lineage for d1j87a1 (1j87 A:1-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein IgE high affinity receptor alpha subunit [49200] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
   Uniprot P12319 29-196

8. Domain d1j87a1: 1j87 A:1-85 [62715]

Details for d1j87a1

PDB Entry: 1j87, 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1

PDB Compounds: (A:) high affinity immunoglobulin epsilon receptor alpha-subunit

SCOPe Domain Sequences for d1j87a1:

Sequence, based on SEQRES records:

>d1j87a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
edsgeykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records):

>d1j87a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
vpqkpkvslnppwnrifkgenvtltcngnnffstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

Timeline for d1j87a1:

• d1j87a1 first appeared in SCOP 1.57
  
• d1j87a1 appears in SCOPe 2.07