Lineage for d1j7vr1 (1j7v R:2-100)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290660Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)
  7. 290661Species Human (Homo sapiens) [TaxId:9606] [63671] (2 PDB entries)
  8. 290666Domain d1j7vr1: 1j7v R:2-100 [62705]
    Other proteins in same PDB: d1j7vl_

Details for d1j7vr1

PDB Entry: 1j7v (more details), 2.9 Å

PDB Description: human il-10 / il-10r1 complex

SCOP Domain Sequences for d1j7vr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7vr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens)}
gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd

SCOP Domain Coordinates for d1j7vr1:

Click to download the PDB-style file with coordinates for d1j7vr1.
(The format of our PDB-style files is described here.)

Timeline for d1j7vr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j7vr2
View in 3D
Domains from other chains:
(mouse over for more information)
d1j7vl_