![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.6: Type IIIa 3',5"-aminoglycoside phosphotransferase [64411] (1 protein) |
![]() | Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [64413] (5 PDB entries) |
![]() | Domain d1j7la_: 1j7l A: [62697] |
PDB Entry: 1j7l (more details), 2.2 Å
SCOP Domain Sequences for d1j7la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis} akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf fdllgikpdwekikyyilldelf
Timeline for d1j7la_: