SCOPe 2.05: Domain d1j7db_: 1j7d B:

Lineage for d1j7db_ (1j7d B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (5 PDB entries)

8. Domain d1j7db_: 1j7d B: [62681]
   complexed with Mms2

Details for d1j7db_

PDB Entry: 1j7d, 1.85 Å

PDB Description: Crystal Structure of hMms2-hUbc13

PDB Compounds: (B:) ubiquitin-conjugating enzyme e2-17 kda

SCOPe Domain Sequences for d1j7db_:

Sequence; same for both SEQRES and ATOM records:

>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn

Timeline for d1j7db_:

• d1j7db_ first appeared in SCOP 1.57
  
• d1j7db_ appears in SCOPe 2.04
  
• d1j7db_ appears in SCOPe 2.06
  
• d1j7db_ appears in the current release, SCOPe 2.08