Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (5 PDB entries) |
Domain d1j7db_: 1j7d B: [62681] complexed with Mms2 |
PDB Entry: 1j7d (more details), 1.85 Å
SCOPe Domain Sequences for d1j7db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl andvaeqwktneaqaietarawtrlyamn
Timeline for d1j7db_: