Lineage for d1j7ba_ (1j7b A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (5 proteins) Protein 2Fe-2S ferredoxin [54294] (12 species) Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries) 
Domain d1j7ba_: 1j7b A: [62678]
Details for d1j7ba_
PDB Entry: 1j7b (more details), 1.8 Å
PDB Description: structure of the anabaena ferredoxin mutant e94k
SCOP Domain Sequences for d1j7ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7ba_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkkedly
SCOP Domain Coordinates for d1j7ba_:
Click to download the PDB-style file with coordinates for d1j7ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j7ba_:
- d1j7ba_ is new in SCOP 1.57
- d1j7ba_ appears in SCOP 1.59
- d1j7ba_ appears in the current release, SCOPe 2.08
View in 3D