Lineage for d1j6xb1 (1j6x B:2-152)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611326Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 2611327Protein Autoinducer-2 production protein LuxS [64295] (5 species)
    S-ribosylhomocysteinase
  7. 2611352Species Helicobacter pylori [TaxId:210] [64299] (1 PDB entry)
  8. 2611354Domain d1j6xb1: 1j6x B:2-152 [62666]
    Other proteins in same PDB: d1j6xa2, d1j6xb2
    complexed with met, zn

Details for d1j6xb1

PDB Entry: 1j6x (more details), 2.38 Å

PDB Description: crystal structure of helicobacter pylori luxs
PDB Compounds: (B:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1j6xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6xb1 d.185.1.2 (B:2-152) Autoinducer-2 production protein LuxS {Helicobacter pylori [TaxId: 210]}
kmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehlv
aeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnekq
cgwaanhtlegaqnlarafldkraewsevgv

SCOPe Domain Coordinates for d1j6xb1:

Click to download the PDB-style file with coordinates for d1j6xb1.
(The format of our PDB-style files is described here.)

Timeline for d1j6xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j6xb2