SCOP 1.71: Domain d1j6xa_: 1j6x A:

Lineage for d1j6xa_ (1j6x A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)

6. Protein Autoinducer-2 production protein LuxS [64295] (4 species)
   S-ribosylhomocysteinase

7. Species Helicobacter pylori [TaxId:210] [64299] (1 PDB entry)

8. Domain d1j6xa_: 1j6x A: [62665]

Details for d1j6xa_

PDB Entry: 1j6x, 2.38 Å

PDB Description: crystal structure of helicobacter pylori luxs

SCOP Domain Sequences for d1j6xa_:

Sequence; same for both SEQRES and ATOM records:

>d1j6xa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Helicobacter pylori}
mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
qcgwaanhtlegaqnlarafldkraewsevg

Timeline for d1j6xa_:

• d1j6xa_ first appeared in SCOP 1.57
  
• d1j6xa_ appears in SCOP 1.69
  
• d1j6xa_ appears in SCOP 1.73
  
• d1j6xa_ appears in the current release, SCOPe 2.08, called d1j6xa1