Lineage for d1j6xa_ (1j6x A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422251Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 422252Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 422402Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
  6. 422403Protein Autoinducer-2 production protein LuxS [64295] (4 species)
    S-ribosylhomocysteinase
  7. 422425Species Helicobacter pylori [TaxId:210] [64299] (1 PDB entry)
  8. 422426Domain d1j6xa_: 1j6x A: [62665]

Details for d1j6xa_

PDB Entry: 1j6x (more details), 2.38 Å

PDB Description: crystal structure of helicobacter pylori luxs

SCOP Domain Sequences for d1j6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6xa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Helicobacter pylori}
mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
qcgwaanhtlegaqnlarafldkraewsevg

SCOP Domain Coordinates for d1j6xa_:

Click to download the PDB-style file with coordinates for d1j6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1j6xa_: