SCOPe 2.08: Domain d1j6xa1: 1j6x A:2-151

Lineage for d1j6xa1 (1j6x A:2-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
   automatically mapped to Pfam PF02664

6. Protein Autoinducer-2 production protein LuxS [64295] (5 species)
   S-ribosylhomocysteinase

7. Species Helicobacter pylori [TaxId:210] [64299] (1 PDB entry)

8. Domain d1j6xa1: 1j6x A:2-151 [62665]
   Other proteins in same PDB: d1j6xa2, d1j6xb2
   complexed with met, zn

Details for d1j6xa1

PDB Entry: 1j6x, 2.38 Å

PDB Description: crystal structure of helicobacter pylori luxs

PDB Compounds: (A:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1j6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1j6xa1 d.185.1.2 (A:2-151) Autoinducer-2 production protein LuxS {Helicobacter pylori [TaxId: 210]}
kmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehlv
aeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnekq
cgwaanhtlegaqnlarafldkraewsevg

Timeline for d1j6xa1:

• d1j6xa1 first appeared in SCOP 1.57, called d1j6xa_
  
• d1j6xa1 appears in SCOPe 2.07