Lineage for d1iqva_ (1iqv A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092301Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1092302Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1092303Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1092304Protein Ribosomal protein S7 [47975] (4 species)
  7. 1092332Species Pyrococcus horikoshii [TaxId:53953] [63577] (1 PDB entry)
  8. 1092333Domain d1iqva_: 1iqv A: [62661]

Details for d1iqva_

PDB Entry: 1iqv (more details), 2.1 Å

PDB Description: crystal structure analysis of the archaebacterial ribosomal protein s7
PDB Compounds: (A:) ribosomal protein s7

SCOPe Domain Sequences for d1iqva_:

Sequence, based on SEQRES records: (download)

>d1iqva_ a.75.1.1 (A:) Ribosomal protein S7 {Pyrococcus horikoshii [TaxId: 53953]}
ikvmgrwstedvevkdpslkpyinleprllphthgrhakkhfgkanvhiverlinkvmrs
ggshykvaghfmrrehrslnskkvrayevvkeafkiiekrtgknpiqvlvwaienaapre
dttsvmfggiryhvavdisplrrldvalrnialgasakcyrtkmsfaealaeeiilaank
dpksyayskkleieriaessr

Sequence, based on observed residues (ATOM records): (download)

>d1iqva_ a.75.1.1 (A:) Ribosomal protein S7 {Pyrococcus horikoshii [TaxId: 53953]}
ikvmgrwstedvevkdpslkpyinleprvhiverlinkvmrsggsskkvrayevvkeafk
iiekrtgknpiqvlvwaienaapredttsvmfggiryhvavdisplrrldvalrnialga
sakcyrtkmsfaealaeeiilaankdpksyayskkleieriaessr

SCOPe Domain Coordinates for d1iqva_:

Click to download the PDB-style file with coordinates for d1iqva_.
(The format of our PDB-style files is described here.)

Timeline for d1iqva_: