Lineage for d1iqva_ (1iqv A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540533Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 540534Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 540535Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 540536Protein Ribosomal protein S7 [47975] (3 species)
  7. 540537Species Archaeon Pyrococcus horikoshii [TaxId:53953] [63577] (1 PDB entry)
  8. 540538Domain d1iqva_: 1iqv A: [62661]

Details for d1iqva_

PDB Entry: 1iqv (more details), 2.1 Å

PDB Description: crystal structure analysis of the archaebacterial ribosomal protein s7

SCOP Domain Sequences for d1iqva_:

Sequence, based on SEQRES records: (download)

>d1iqva_ a.75.1.1 (A:) Ribosomal protein S7 {Archaeon Pyrococcus horikoshii}
ikvmgrwstedvevkdpslkpyinleprllphthgrhakkhfgkanvhiverlinkvmrs
ggshykvaghfmrrehrslnskkvrayevvkeafkiiekrtgknpiqvlvwaienaapre
dttsvmfggiryhvavdisplrrldvalrnialgasakcyrtkmsfaealaeeiilaank
dpksyayskkleieriaessr

Sequence, based on observed residues (ATOM records): (download)

>d1iqva_ a.75.1.1 (A:) Ribosomal protein S7 {Archaeon Pyrococcus horikoshii}
ikvmgrwstedvevkdpslkpyinleprvhiverlinkvmrsggsskkvrayevvkeafk
iiekrtgknpiqvlvwaienaapredttsvmfggiryhvavdisplrrldvalrnialga
sakcyrtkmsfaealaeeiilaankdpksyayskkleieriaessr

SCOP Domain Coordinates for d1iqva_:

Click to download the PDB-style file with coordinates for d1iqva_.
(The format of our PDB-style files is described here.)

Timeline for d1iqva_: