Lineage for d1iqdc_ (1iqd C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1304998Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 1305013Protein C2 domain of factor VIII [49794] (1 species)
  7. 1305014Species Human (Homo sapiens) [TaxId:9606] [49795] (4 PDB entries)
  8. 1305018Domain d1iqdc_: 1iqd C: [62648]
    Other proteins in same PDB: d1iqda1, d1iqda2, d1iqdb1, d1iqdb2

Details for d1iqdc_

PDB Entry: 1iqd (more details), 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.
PDB Compounds: (C:) human factor viii

SCOPe Domain Sequences for d1iqdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqdc_ b.18.1.2 (C:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]}
csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
vncldpplltrylrihpqswvhqialrmevlgceaq

SCOPe Domain Coordinates for d1iqdc_:

Click to download the PDB-style file with coordinates for d1iqdc_.
(The format of our PDB-style files is described here.)

Timeline for d1iqdc_: