Class b: All beta proteins [48724] (165 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) |
Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (3 proteins) |
Protein C2 domain of factor VIII [49794] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49795] (2 PDB entries) |
Domain d1iqdc_: 1iqd C: [62648] Other proteins in same PDB: d1iqda1, d1iqda2, d1iqdb1, d1iqdb2 mutant |
PDB Entry: 1iqd (more details), 2 Å
SCOP Domain Sequences for d1iqdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqdc_ b.18.1.2 (C:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv vncldpplltrylrihpqswvhqialrmevlgceaq
Timeline for d1iqdc_:
View in 3D Domains from other chains: (mouse over for more information) d1iqda1, d1iqda2, d1iqdb1, d1iqdb2 |