Lineage for d1iqdc_ (1iqd C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107983Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 107984Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families) (S)
  5. 107997Family b.18.1.2: Coagulation factor C2 domain [49791] (2 proteins)
  6. 108004Protein C2 domain of factor VIII [49794] (1 species)
  7. 108005Species Human (Homo sapiens) [TaxId:9606] [49795] (2 PDB entries)
  8. 108007Domain d1iqdc_: 1iqd C: [62648]
    Other proteins in same PDB: d1iqda1, d1iqda2, d1iqdb1, d1iqdb2

Details for d1iqdc_

PDB Entry: 1iqd (more details), 2 Å

PDB Description: Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.

SCOP Domain Sequences for d1iqdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqdc_ b.18.1.2 (C:) C2 domain of factor VIII {Human (Homo sapiens)}
csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
vncldpplltrylrihpqswvhqialrmevlgceaq

SCOP Domain Coordinates for d1iqdc_:

Click to download the PDB-style file with coordinates for d1iqdc_.
(The format of our PDB-style files is described here.)

Timeline for d1iqdc_: