SCOP 1.57: Domain d1iqdc_: 1iqd C:

Lineage for d1iqdc_ (1iqd C:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families)

5. Family b.18.1.2: Coagulation factor C2 domain [49791] (2 proteins)

6. Protein C2 domain of factor VIII [49794] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49795] (2 PDB entries)

8. Domain d1iqdc_: 1iqd C: [62648]
   Other proteins in same PDB: d1iqda1, d1iqda2, d1iqdb1, d1iqdb2

Details for d1iqdc_

PDB Entry: 1iqd, 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

SCOP Domain Sequences for d1iqdc_:

Sequence; same for both SEQRES and ATOM records:

>d1iqdc_ b.18.1.2 (C:) C2 domain of factor VIII {Human (Homo sapiens)}
csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
vncldpplltrylrihpqswvhqialrmevlgceaq

Timeline for d1iqdc_:

• d1iqdc_ is new in SCOP 1.57
  
• d1iqdc_ appears in SCOP 1.59
  
• d1iqdc_ appears in the current release, SCOPe 2.08