Lineage for d1iqdb2 (1iqd B:115-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104096Species Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain [63658] (1 PDB entry)
  8. 104098Domain d1iqdb2: 1iqd B:115-212 [62647]
    Other proteins in same PDB: d1iqda1, d1iqdb1, d1iqdc_

Details for d1iqdb2

PDB Entry: 1iqd (more details), 2 Å

PDB Description: Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.

SCOP Domain Sequences for d1iqdb2:

Sequence, based on SEQRES records: (download)

>d1iqdb2 b.1.1.2 (B:115-212) Immunoglobulin (constant domains of L and H chains) {Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtatytcnvdhkpsntkvdkrv

Sequence, based on observed residues (ATOM records): (download)

>d1iqdb2 b.1.1.2 (B:115-212) Immunoglobulin (constant domains of L and H chains) {Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain}
astkgpsvfplataalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvtatytcnvdhkpsntkvdkrv

SCOP Domain Coordinates for d1iqdb2:

Click to download the PDB-style file with coordinates for d1iqdb2.
(The format of our PDB-style files is described here.)

Timeline for d1iqdb2: