Lineage for d1iqdb1 (1iqd B:1-114)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362802Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)
  8. 362809Domain d1iqdb1: 1iqd B:1-114 [62646]
    Other proteins in same PDB: d1iqda1, d1iqda2, d1iqdb2, d1iqdc_
    part of intact IgG B12 antibody
    mutant

Details for d1iqdb1

PDB Entry: 1iqd (more details), 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

SCOP Domain Sequences for d1iqdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvqlvqsgaevkkpgasvkvsckvsgytltelpvhwvrqapgkglewvgsfdpesgesiy
arefqgsvtmtadtstniaymelsslrsddtavyycavpdpdafdiwgqgtmvtvss

SCOP Domain Coordinates for d1iqdb1:

Click to download the PDB-style file with coordinates for d1iqdb1.
(The format of our PDB-style files is described here.)

Timeline for d1iqdb1: