Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1iqda2: 1iqd A:109-212 [62645] Other proteins in same PDB: d1iqda1, d1iqdb1, d1iqdb2, d1iqdc_ part of Fab BO2C11 against the C2 domain of factor VIII mutant |
PDB Entry: 1iqd (more details), 2 Å
SCOP Domain Sequences for d1iqda2:
Sequence, based on SEQRES records: (download)
>d1iqda2 b.1.1.2 (A:109-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} gtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
>d1iqda2 b.1.1.2 (A:109-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} gtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglvtksfnr
Timeline for d1iqda2: