Lineage for d1iqda1 (1iqd A:2-108)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102549Species Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain [63647] (1 PDB entry)
  8. 102550Domain d1iqda1: 1iqd A:2-108 [62644]
    Other proteins in same PDB: d1iqda2, d1iqdb2, d1iqdc_

Details for d1iqda1

PDB Entry: 1iqd (more details), 2 Å

PDB Description: Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.

SCOP Domain Sequences for d1iqda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqda1 b.1.1.1 (A:2-108) Immunoglobulin (variable domains of L and H chains) {Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain}
ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleik

SCOP Domain Coordinates for d1iqda1:

Click to download the PDB-style file with coordinates for d1iqda1.
(The format of our PDB-style files is described here.)

Timeline for d1iqda1: