![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain [63647] (1 PDB entry) |
![]() | Domain d1iqda1: 1iqd A:2-108 [62644] Other proteins in same PDB: d1iqda2, d1iqdb2, d1iqdc_ |
PDB Entry: 1iqd (more details), 2 Å
SCOP Domain Sequences for d1iqda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqda1 b.1.1.1 (A:2-108) Immunoglobulin (variable domains of L and H chains) {Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain} ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleik
Timeline for d1iqda1: