SCOP 1.57: Domain d1iqda1: 1iqd A:2-108

Lineage for d1iqda1 (1iqd A:2-108)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain [63647] (1 PDB entry)

8. Domain d1iqda1: 1iqd A:2-108 [62644]
   Other proteins in same PDB: d1iqda2, d1iqdb2, d1iqdc_

Details for d1iqda1

PDB Entry: 1iqd, 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

SCOP Domain Sequences for d1iqda1:

Sequence; same for both SEQRES and ATOM records:

>d1iqda1 b.1.1.1 (A:2-108) Immunoglobulin (variable domains of L and H chains) {Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain}
ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleik

Timeline for d1iqda1:

• d1iqda1 is new in SCOP 1.57
  
• d1iqda1 appears in SCOP 1.59
  
• d1iqda1 appears in the current release, SCOPe 2.08