Lineage for d1iq4b_ (1iq4 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209370Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 1209371Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 1209372Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 1209373Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 1209374Species Bacillus stearothermophilus [TaxId:1422] [64317] (1 PDB entry)
  8. 1209376Domain d1iq4b_: 1iq4 B: [62642]

Details for d1iq4b_

PDB Entry: 1iq4 (more details), 1.8 Å

PDB Description: 5s-rrna binding ribosomal protein l5 from bacillus stearothermophilus
PDB Compounds: (B:) 50S ribosomal protein L5

SCOPe Domain Sequences for d1iq4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq4b_ d.77.1.1 (B:) Ribosomal protein L5 {Bacillus stearothermophilus [TaxId: 1422]}
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk

SCOPe Domain Coordinates for d1iq4b_:

Click to download the PDB-style file with coordinates for d1iq4b_.
(The format of our PDB-style files is described here.)

Timeline for d1iq4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iq4a_