Lineage for d1ioqa_ (1ioq A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76115Species Chicken (Gallus gallus) [TaxId:9031] [53962] (142 PDB entries)
  8. 76157Domain d1ioqa_: 1ioq A: [62634]

Details for d1ioqa_

PDB Entry: 1ioq (more details), 1.79 Å

PDB Description: stabilization of hen egg white lysozyme by a cavity-filling mutation

SCOP Domain Sequences for d1ioqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioqa_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaafkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygifqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1ioqa_:

Click to download the PDB-style file with coordinates for d1ioqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ioqa_: