SCOP 1.73: Domain d1ioda_: 1iod A:

Lineage for d1ioda_ (1iod A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId:36307] [88865] (3 PDB entries)

8. Domain d1ioda_: 1iod A: [62622]
   Other proteins in same PDB: d1iodb_, d1iodg_
   complexed with ca

Details for d1ioda_

PDB Entry: 1iod, 2.3 Å

PDB Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x

PDB Compounds: (A:) coagulation factor x binding protein

SCOP Domain Sequences for d1ioda_:

Sequence; same for both SEQRES and ATOM records:

>d1ioda_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId: 36307]}
dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik
sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
qqdpfvcea

Timeline for d1ioda_:

• d1ioda_ first appeared in SCOP 1.57
  
• d1ioda_ appears in SCOP 1.71
  
• d1ioda_ appears in SCOP 1.75
  
• d1ioda_ appears in the current release, SCOPe 2.08