Lineage for d1ioda_ (1iod A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336965Protein Snake coagglutinin alpha chain [88861] (5 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 336981Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88865] (1 PDB entry)
  8. 336982Domain d1ioda_: 1iod A: [62622]
    Other proteins in same PDB: d1iodb_, d1iodg_
    complexed with ca

Details for d1ioda_

PDB Entry: 1iod (more details), 2.3 Å

PDB Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x

SCOP Domain Sequences for d1ioda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioda_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Sharp-nosed viper (Deinagkistrodon acutus)}
dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik
sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
qqdpfvcea

SCOP Domain Coordinates for d1ioda_:

Click to download the PDB-style file with coordinates for d1ioda_.
(The format of our PDB-style files is described here.)

Timeline for d1ioda_: