Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein Class II ribonuclease H (RNase HII) [53103] (5 species) |
Species Thermococcus kodakaraensis [TaxId:311400] [64094] (1 PDB entry) |
Domain d1io2a_: 1io2 A: [62612] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1io2 (more details), 2 Å
SCOPe Domain Sequences for d1io2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io2a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Thermococcus kodakaraensis [TaxId: 311400]} mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl enyyrehgefppivrkgwktlkkiaekvesekk
Timeline for d1io2a_: