SCOP 1.59: Domain d1innb_: 1inn B:

Lineage for d1innb_ (1inn B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)

6. Protein Autoinducer-2 production protein LuxS [64295] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [64297] (2 PDB entries)

8. Domain d1innb_: 1inn B: [62609]

Details for d1innb_

PDB Entry: 1inn, 1.8 Å

PDB Description: crystal structure of d. radiodurans luxs, p21

SCOP Domain Sequences for d1innb_:

Sequence; same for both SEQRES and ATOM records:

>d1innb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans}
vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
nyrdhdlaaarqhardvldqglkvqetill

Timeline for d1innb_:

• d1innb_ first appeared in SCOP 1.57
  
• d1innb_ appears in SCOP 1.61
  
• d1innb_ appears in the current release, SCOPe 2.08