![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() |
![]() | Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein) |
![]() | Protein Autoinducer-2 production protein LuxS [64295] (4 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [64297] (2 PDB entries) |
![]() | Domain d1innb_: 1inn B: [62609] |
PDB Entry: 1inn (more details), 1.8 Å
SCOP Domain Sequences for d1innb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1innb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans} vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg nyrdhdlaaarqhardvldqglkvqetill
Timeline for d1innb_: