SCOPe 2.05: Domain d1im9e2: 1im9 E:1-181

Lineage for d1im9e2 (1im9 E:1-181)

Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [54478] (2 PDB entries)
Domain d1im9e2: 1im9 E:1-181 [62588]
Other proteins in same PDB: d1im9a1, d1im9b_, d1im9d1, d1im9d2, d1im9e1, d1im9f_

Details for d1im9e2

PDB Entry: 1im9 (more details), 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

PDB Compounds: (E:) hla class I histocompatibility antigen, cw-4 cw*0401 alpha chain

SCOPe Domain Sequences for d1im9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im9e2 d.19.1.1 (E:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW4 [TaxId: 9606]}
gshsmryfstsvswpgrgeprfiavgyvddtqfvrfdsdaasprgeprepwveqegpeyw
dretqkykrqaqadrvnlrklrgyynqsedgshtlqrmfgcdlgpdgrllrgynqfaydg
kdyialnedlrswtaadtaaqitqrkweaareaeqrraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1im9e2:

Click to download the PDB-style file with coordinates for d1im9e2.
(The format of our PDB-style files is described here.)

Timeline for d1im9e2: