Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [48956] (2 PDB entries) |
Domain d1im9e1: 1im9 E:182-275 [62587] Other proteins in same PDB: d1im9a2, d1im9d1, d1im9d2, d1im9e2 |
PDB Entry: 1im9 (more details), 2.8 Å
SCOP Domain Sequences for d1im9e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1im9e1 b.1.1.2 (E:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-CW4} aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpepltlrwk
Timeline for d1im9e1: