| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.4: I set domains [49159] (38 proteins) |
| Protein Killer cell inhibitory receptor [49202] (4 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries) |
| Domain d1im9d2: 1im9 D:102-200 [62586] Other proteins in same PDB: d1im9a1, d1im9a2, d1im9b_, d1im9e1, d1im9e2, d1im9f_ |
PDB Entry: 1im9 (more details), 2.8 Å
SCOP Domain Sequences for d1im9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1im9d2 b.1.1.4 (D:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]}
iglyekpslsaqpgptvlagenvtlscssrssydmyhlsregeaherrlpagpkvngtfq
adfplgpathggtyrcfgsfhdspyewskssdpllvsvt
Timeline for d1im9d2: