Lineage for d1im9d2 (1im9 D:102-200)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54398Protein Killer cell inhibitory receptor [49202] (3 species)
  7. 54411Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)
  8. 54415Domain d1im9d2: 1im9 D:102-200 [62586]
    Other proteins in same PDB: d1im9a1, d1im9a2, d1im9b1, d1im9e1, d1im9e2, d1im9f1

Details for d1im9d2

PDB Entry: 1im9 (more details), 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

SCOP Domain Sequences for d1im9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im9d2 b.1.1.4 (D:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir}
iglyekpslsaqpgptvlagenvtlscssrssydmyhlsregeaherrlpagpkvngtfq
adfplgpathggtyrcfgsfhdspyewskssdpllvsvt

SCOP Domain Coordinates for d1im9d2:

Click to download the PDB-style file with coordinates for d1im9d2.
(The format of our PDB-style files is described here.)

Timeline for d1im9d2: