Lineage for d1im9d1 (1im9 D:6-101)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 222108Family b.1.1.4: I set domains [49159] (27 proteins)
  6. 222240Protein Killer cell inhibitory receptor [49202] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 222253Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)
  8. 222256Domain d1im9d1: 1im9 D:6-101 [62585]
    Other proteins in same PDB: d1im9a1, d1im9a2, d1im9b_, d1im9e1, d1im9e2, d1im9f_

Details for d1im9d1

PDB Entry: 1im9 (more details), 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

SCOP Domain Sequences for d1im9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im9d1 b.1.1.4 (D:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir}
rkpsllahpgplvkseetvilqcwsdvmfehfllhregmfndtlrligehhdgvskanfs
isrmtqdlagtyrcygsvthspyqvsapsdpldivi

SCOP Domain Coordinates for d1im9d1:

Click to download the PDB-style file with coordinates for d1im9d1.
(The format of our PDB-style files is described here.)

Timeline for d1im9d1: