SCOP 1.57: Domain d1im9a2: 1im9 A:1-181

Lineage for d1im9a2 (1im9 A:1-181)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)

7. Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [54478] (2 PDB entries)

8. Domain d1im9a2: 1im9 A:1-181 [62583]
   Other proteins in same PDB: d1im9a1, d1im9b1, d1im9d1, d1im9d2, d1im9e1, d1im9f1

Details for d1im9a2

PDB Entry: 1im9, 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

SCOP Domain Sequences for d1im9a2:

Sequence; same for both SEQRES and ATOM records:

>d1im9a2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW4}
gshsmryfstsvswpgrgeprfiavgyvddtqfvrfdsdaasprgeprepwveqegpeyw
dretqkykrqaqadrvnlrklrgyynqsedgshtlqrmfgcdlgpdgrllrgynqfaydg
kdyialnedlrswtaadtaaqitqrkweaareaeqrraylegtcvewlrrylengketlq
r

Timeline for d1im9a2:

• d1im9a2 is new in SCOP 1.57
  
• d1im9a2 appears in SCOP 1.59
  
• d1im9a2 appears in the current release, SCOPe 2.08