Lineage for d1im9a2 (1im9 A:1-181)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78661Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 78735Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [54478] (2 PDB entries)
  8. 78737Domain d1im9a2: 1im9 A:1-181 [62583]
    Other proteins in same PDB: d1im9a1, d1im9b1, d1im9d1, d1im9d2, d1im9e1, d1im9f1

Details for d1im9a2

PDB Entry: 1im9 (more details), 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

SCOP Domain Sequences for d1im9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im9a2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW4}
gshsmryfstsvswpgrgeprfiavgyvddtqfvrfdsdaasprgeprepwveqegpeyw
dretqkykrqaqadrvnlrklrgyynqsedgshtlqrmfgcdlgpdgrllrgynqfaydg
kdyialnedlrswtaadtaaqitqrkweaareaeqrraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1im9a2:

Click to download the PDB-style file with coordinates for d1im9a2.
(The format of our PDB-style files is described here.)

Timeline for d1im9a2: