Lineage for d1im9a1 (1im9 A:182-275)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 158963Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [48956] (2 PDB entries)
  8. 158966Domain d1im9a1: 1im9 A:182-275 [62582]
    Other proteins in same PDB: d1im9a2, d1im9d1, d1im9d2, d1im9e2

Details for d1im9a1

PDB Entry: 1im9 (more details), 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

SCOP Domain Sequences for d1im9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im9a1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-CW4}
aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepltlrwk

SCOP Domain Coordinates for d1im9a1:

Click to download the PDB-style file with coordinates for d1im9a1.
(The format of our PDB-style files is described here.)

Timeline for d1im9a1: