SCOP 1.69: Domain d1im3m1: 1im3 M:182-275

Lineage for d1im3m1 (1im3 M:182-275)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)

8. Domain d1im3m1: 1im3 M:182-275 [62577]
   Other proteins in same PDB: d1im3a2, d1im3b_, d1im3d_, d1im3e2, d1im3f_, d1im3h_, d1im3i2, d1im3j_, d1im3l_, d1im3m2, d1im3n_, d1im3p_

Details for d1im3m1

PDB Entry: 1im3, 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax

SCOP Domain Sequences for d1im3m1:

Sequence; same for both SEQRES and ATOM records:

>d1im3m1 b.1.1.2 (M:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1im3m1:

• d1im3m1 first appeared in SCOP 1.57
  
• d1im3m1 appears in SCOP 1.67
  
• d1im3m1 appears in SCOP 1.71
  
• d1im3m1 appears in the current release, SCOPe 2.08