Lineage for d1im3m1 (1im3 M:182-275)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364613Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)
  8. 364645Domain d1im3m1: 1im3 M:182-275 [62577]
    Other proteins in same PDB: d1im3a2, d1im3b_, d1im3d_, d1im3e2, d1im3f_, d1im3h_, d1im3i2, d1im3j_, d1im3l_, d1im3m2, d1im3n_, d1im3p_

Details for d1im3m1

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax

SCOP Domain Sequences for d1im3m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3m1 b.1.1.2 (M:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1im3m1:

Click to download the PDB-style file with coordinates for d1im3m1.
(The format of our PDB-style files is described here.)

Timeline for d1im3m1: