SCOP 1.61: Domain d1im3l_: 1im3 L:

Lineage for d1im3l_ (1im3 L:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)

6. Protein Cytomegalovirus protein US2 [63668] (1 species)

7. Species Human cytomegalovirus [TaxId:10359] [63669] (1 PDB entry)

8. Domain d1im3l_: 1im3 L: [62576]
   Other proteins in same PDB: d1im3a1, d1im3a2, d1im3b1, d1im3e1, d1im3e2, d1im3f1, d1im3i1, d1im3i2, d1im3j1, d1im3m1, d1im3m2, d1im3n1

Details for d1im3l_

PDB Entry: 1im3, 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax

SCOP Domain Sequences for d1im3l_:

Sequence; same for both SEQRES and ATOM records:

>d1im3l_ b.1.1.6 (L:) Cytomegalovirus protein US2 {Human cytomegalovirus}
pwfqiednrcyidngklfargsivgnmsrfvfdpkadyggvgenlyvhaddvefvpgesl
kwnvrnldvmpifetlalrlvlqgdviwlrcvpel

Timeline for d1im3l_:

• d1im3l_ first appeared in SCOP 1.57
  
• d1im3l_ appears in SCOP 1.59
  
• d1im3l_ appears in SCOP 1.63
  
• d1im3l_ appears in the current release, SCOPe 2.08