Lineage for d1im3l_ (1im3 L:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 105210Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)
  6. 105214Protein Cytomegalovirus protein US2 [63668] (1 species)
  7. 105215Species Human cytomegalovirus [TaxId:10359] [63669] (1 PDB entry)
  8. 105218Domain d1im3l_: 1im3 L: [62576]
    Other proteins in same PDB: d1im3a1, d1im3a2, d1im3b1, d1im3e1, d1im3e2, d1im3f1, d1im3i1, d1im3i2, d1im3j1, d1im3m1, d1im3m2, d1im3n1

Details for d1im3l_

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax
PDB Compounds: (L:)

SCOP Domain Sequences for d1im3l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3l_ b.1.1.6 (L:) Cytomegalovirus protein US2 {Human cytomegalovirus}
pwfqiednrcyidngklfargsivgnmsrfvfdpkadyggvgenlyvhaddvefvpgesl
kwnvrnldvmpifetlalrlvlqgdviwlrcvpel

SCOP Domain Coordinates for d1im3l_:

Click to download the PDB-style file with coordinates for d1im3l_.
(The format of our PDB-style files is described here.)

Timeline for d1im3l_: