Lineage for d1im3h_ (1im3 H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937905Family b.1.18.5: Cytomegalovirus protein US2 [81285] (1 protein)
  6. 937906Protein Cytomegalovirus protein US2 [63668] (1 species)
    similar to both C1 and C2 set
  7. 937907Species Human cytomegalovirus [TaxId:10359] [63669] (1 PDB entry)
  8. 937909Domain d1im3h_: 1im3 H: [62572]
    Other proteins in same PDB: d1im3a1, d1im3a2, d1im3b_, d1im3e1, d1im3e2, d1im3f_, d1im3i1, d1im3i2, d1im3j_, d1im3m1, d1im3m2, d1im3n_

Details for d1im3h_

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax
PDB Compounds: (H:) cytomegalovirus protein US2

SCOPe Domain Sequences for d1im3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3h_ b.1.18.5 (H:) Cytomegalovirus protein US2 {Human cytomegalovirus [TaxId: 10359]}
pwfqiednrcyidngklfargsivgnmsrfvfdpkadyggvgenlyvhaddvefvpgesl
kwnvrnldvmpifetlalrlvlqgdviwlrcvpel

SCOPe Domain Coordinates for d1im3h_:

Click to download the PDB-style file with coordinates for d1im3h_.
(The format of our PDB-style files is described here.)

Timeline for d1im3h_: