Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
Domain d1im3e2: 1im3 E:1-181 [62570] Other proteins in same PDB: d1im3a1, d1im3b_, d1im3d_, d1im3e1, d1im3f_, d1im3h_, d1im3i1, d1im3j_, d1im3l_, d1im3m1, d1im3n_, d1im3p_ |
PDB Entry: 1im3 (more details), 2.2 Å
SCOPe Domain Sequences for d1im3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1im3e2 d.19.1.1 (E:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d1im3e2: