Lineage for d1im3e1 (1im3 E:182-275)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452843Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 452844Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)
  8. 452874Domain d1im3e1: 1im3 E:182-275 [62569]
    Other proteins in same PDB: d1im3a2, d1im3b_, d1im3d_, d1im3e2, d1im3f_, d1im3h_, d1im3i2, d1im3j_, d1im3l_, d1im3m2, d1im3n_, d1im3p_

Details for d1im3e1

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax
PDB Compounds: (E:)

SCOP Domain Sequences for d1im3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3e1 b.1.1.2 (E:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1im3e1:

Click to download the PDB-style file with coordinates for d1im3e1.
(The format of our PDB-style files is described here.)

Timeline for d1im3e1: