Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.5: Cytomegalovirus protein US2 [81285] (1 protein) automatically mapped to Pfam PF05963 |
Protein Cytomegalovirus protein US2 [63668] (1 species) similar to both C1 and C2 set |
Species Human cytomegalovirus [TaxId:10359] [63669] (1 PDB entry) |
Domain d1im3d_: 1im3 D: [62568] Other proteins in same PDB: d1im3a1, d1im3a2, d1im3b_, d1im3e1, d1im3e2, d1im3f_, d1im3i1, d1im3i2, d1im3j_, d1im3m1, d1im3m2, d1im3n_ |
PDB Entry: 1im3 (more details), 2.2 Å
SCOPe Domain Sequences for d1im3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1im3d_ b.1.18.5 (D:) Cytomegalovirus protein US2 {Human cytomegalovirus [TaxId: 10359]} pwfqiednrcyidngklfargsivgnmsrfvfdpkadyggvgenlyvhaddvefvpgesl kwnvrnldvmpifetlalrlvlqgdviwlrcvpel
Timeline for d1im3d_: