SCOPe 2.07: Domain d1il1b1: 1il1 B:1-112

Lineage for d1il1b1 (1il1 B:1-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)

8. Domain d1il1b1: 1il1 B:1-112 [62541]
   Other proteins in same PDB: d1il1a1, d1il1a2, d1il1b2
   part of anti-HIV Fab G3-519

Details for d1il1b1

PDB Entry: 1il1, 2.2 Å

PDB Description: Crystal structure of G3-519, an anti-HIV monoclonal antibody

PDB Compounds: (B:) monoclonal antibody G3-519 (light chain)

SCOPe Domain Sequences for d1il1b1:

Sequence; same for both SEQRES and ATOM records:

>d1il1b1 b.1.1.1 (B:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsvgekvtmsckssqsllysrnqmnylswyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvkaedlavyycqqyyhyrtfgggtrleir

Timeline for d1il1b1:

• d1il1b1 first appeared in SCOP 1.57
  
• d1il1b1 appears in SCOPe 2.06
  
• d1il1b1 appears in the current release, SCOPe 2.08